About Dark Proteome Database  

DPD

Simplifying the generation of insight from protein structures

Nelson Perdigão1,2, Agostinho Rosa1,2, Seán I. O’Donoghue3

Updated: June 2016
This indicates when the Dark Proteome Database (DPD) was last calculated.
PDB structures released since then are not yet available in DPD.

1. University of Lisbon, Portugal
2. Instituto de Sistemas e Robótica, Lisboa, Portugal
3. Garvan Institute of Medical Research, Sydney, Australia

Q9H324 - 1-234 - Dark | 9606

Sequence:

MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVASPSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCLYAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGGPKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRS

Length: 234

Number of Swiss-Prot Features: 10

Swiss-Prot Features

variant_2,,T -> S (in dbSNP:rs7255721) {ECO:0000269|PubMed:15355968}. /FTId=VAR_054441.,,134:134;
variant in WMS1_1,,A -> T (in WMS1; shows consistent and significantly diminished protein secretion). {ECO:0000269|PubMed:18567016}. /FTId=VAR_054439.,,25:25;
variant_1,,R -> Q (in dbSNP:rs3814291) /FTId=VAR_054440.,,119:119;
carbohyd_2,,N-linked (GlcNAc...). {ECO:0000255},,222:222;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,234:234;
compbias_1,,Poly-Pro,,58:61;
carbohyd_1,,N-linked (GlcNAc...). {ECO:0000255},,90:90;
propep_1,,{ECO:0000250} /FTId=PRO_0000029184.,,26:233;
signal_1,,{ECO:0000255},,1:25;
var_seq_1,,MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEI AFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVAS PSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCL YAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGG PKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGR PWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVV ADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNIL VTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHG NAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGM CERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCG ARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGL CLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKY GEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYK RVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHC DSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSE FDSIPFRGKFYKWKTYRGGGVK -> MGPTSVLRAGLTPSC LPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAA ACPLLAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPR TSEKCSVLNLTASLSVGNSTSGKRTGE (in isoform 2). {ECO:0000305}. /FTId=VSP_054707.,,1:234;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein): 60-68, 165-169, 199-202, 214-231,

Q9H324 - 235-326 - White | 9606

Sequence:

VSRERYVETLVVADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNILVTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSG

Length: 92

Number of Swiss-Prot Features: 5

Swiss-Prot Features

domain_1,,Peptidase M12B. {ECO:0000255|PROSITE-ProRule:PRU00276}.,,239:326;
carbohyd_3,,N-linked (GlcNAc...). {ECO:0000255},,323:323;
var_seq_1,,MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEI AFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVAS PSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCL YAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGG PKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGR PWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVV ADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNIL VTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHG NAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGM CERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCG ARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGL CLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKY GEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYK RVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHC DSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSE FDSIPFRGKFYKWKTYRGGGVK -> MGPTSVLRAGLTPSC LPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAA ACPLLAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPR TSEKCSVLNLTASLSVGNSTSGKRTGE (in isoform 2). {ECO:0000305}. /FTId=VSP_054707.,,235:326;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,235:326;
disulfid_1,,{ECO:0000250},,315:326;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 327-333 - Dark | 9606

Sequence:

HGNAIPE

Length: 7

Number of Swiss-Prot Features: 4

Swiss-Prot Features

domain_1,,Peptidase M12B. {ECO:0000255|PROSITE-ProRule:PRU00276}.,,327:333;
disulfid_1,,{ECO:0000250},,327:333;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,327:333;
var_seq_1,,MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEI AFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVAS PSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCL YAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGG PKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGR PWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVV ADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNIL VTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHG NAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGM CERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCG ARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGL CLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKY GEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYK RVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHC DSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSE FDSIPFRGKFYKWKTYRGGGVK -> MGPTSVLRAGLTPSC LPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAA ACPLLAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPR TSEKCSVLNLTASLSVGNSTSGKRTGE (in isoform 2). {ECO:0000305}. /FTId=VSP_054707.,,327:333;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 334-354 - White | 9606

Sequence:

NGVANHDTAVLITRYDICIYK

Length: 21

Number of Swiss-Prot Features: 5

Swiss-Prot Features

chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,334:354;
disulfid_1,,{ECO:0000250},,334:354;
disulfid_2,,{ECO:0000250},,351:354;
var_seq_1,,MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEI AFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVAS PSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCL YAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGG PKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGR PWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVV ADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNIL VTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHG NAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGM CERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCG ARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGL CLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKY GEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYK RVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHC DSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSE FDSIPFRGKFYKWKTYRGGGVK -> MGPTSVLRAGLTPSC LPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAA ACPLLAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPR TSEKCSVLNLTASLSVGNSTSGKRTGE (in isoform 2). {ECO:0000305}. /FTId=VSP_054707.,,334:354;
domain_1,,Peptidase M12B. {ECO:0000255|PROSITE-ProRule:PRU00276}.,,334:354;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 355-355 - Dark | 9606

Sequence:

N

Length: 1

Number of Swiss-Prot Features: 5

Swiss-Prot Features

var_seq_1,,MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEI AFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVAS PSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCL YAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGG PKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGR PWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVV ADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNIL VTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHG NAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGM CERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCG ARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGL CLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKY GEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYK RVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHC DSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSE FDSIPFRGKFYKWKTYRGGGVK -> MGPTSVLRAGLTPSC LPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAA ACPLLAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPR TSEKCSVLNLTASLSVGNSTSGKRTGE (in isoform 2). {ECO:0000305}. /FTId=VSP_054707.,,355:355;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,355:355;
disulfid_1,,{ECO:0000250},,355:355;
domain_1,,Peptidase M12B. {ECO:0000255|PROSITE-ProRule:PRU00276}.,,355:355;
disulfid_2,,{ECO:0000250},,355:355;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 356-524 - White | 9606

Sequence:

KPCGTLGLAPVGGMCERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTH

Length: 169

Number of Swiss-Prot Features: 18

Swiss-Prot Features

disulfid_3,,{ECO:0000250},,370:452;
disulfid_6,,{ECO:0000250},,490:508;
disulfid_7,,{ECO:0000250},,496:524;
var_seq_1,,MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEI AFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVAS PSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCL YAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGG PKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGR PWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVV ADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNIL VTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHG NAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGM CERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCG ARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGL CLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKY GEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYK RVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHC DSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSE FDSIPFRGKFYKWKTYRGGGVK -> MGPTSVLRAGLTPSC LPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAA ACPLLAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPR TSEKCSVLNLTASLSVGNSTSGKRTGE (in isoform 2). {ECO:0000305}. /FTId=VSP_054707.,,356:524;
domain_2,,Disintegrin,,460:524;
domain_1,,Peptidase M12B. {ECO:0000255|PROSITE-ProRule:PRU00276}.,,356:457;
conflict_1,,AT -> PQ (in Ref. 2; AAG35563) {ECO:0000305}.,,385:386;
metal_2,,Zinc; catalytic. {ECO:0000250},,396:396;
disulfid_1,,{ECO:0000250},,356:376;
disulfid_5,,{ECO:0000250},,479:501;
disulfid_4,,{ECO:0000250},,409:436;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,356:524;
conflict_2,,S -> N (in Ref. 2; AAG35563) {ECO:0000305}.,,437:437;
metal_3,,Zinc; catalytic. {ECO:0000250},,402:402;
metal_1,,Zinc; catalytic. {ECO:0000250},,392:392;
disulfid_8,,{ECO:0000250},,521:524;
act_site_1,,{ECO:0000255|PROSITE-ProRule:PRU00276, ECO:0000255|PROSITE-ProRule:PRU10095}.,,393:393;
disulfid_2,,{ECO:0000250},,356:358;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein): 357-364,

Predicted Disorder Sections (Predict Protein):

Q9H324 - 525-527 - Dark | 9606

Sequence:

TID

Length: 3

Number of Swiss-Prot Features: 5

Swiss-Prot Features

chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,525:527;
disulfid_8,,{ECO:0000250},,525:527;
domain_2,,Disintegrin,,525:527;
var_seq_1,,MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEI AFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVAS PSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCL YAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGG PKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGR PWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVV ADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNIL VTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHG NAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGM CERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCG ARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGL CLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKY GEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYK RVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHC DSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSE FDSIPFRGKFYKWKTYRGGGVK -> MGPTSVLRAGLTPSC LPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAA ACPLLAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPR TSEKCSVLNLTASLSVGNSTSGKRTGE (in isoform 2). {ECO:0000305}. /FTId=VSP_054707.,,525:527;
disulfid_7,,{ECO:0000250},,525:527;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 528-718 - White | 9606

Sequence:

KGWCYKRVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSEFDSIPFRGKFYKWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVDGTPCRPDTVDICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSACETIEGVFSPASPG

Length: 191

Number of Swiss-Prot Features: 13

Swiss-Prot Features

domain_3,,TSP type-1 1. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,547:602;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,528:718;
disulfid_10,,{ECO:0000250},,563:601;
compbias_2,,Poly-Ser,,568:571;
disulfid_11,,{ECO:0000250},,574:586;
conflict_3,,C -> S (in Ref. 2; AAG35563) {ECO:0000305}.,,643:643;
disulfid_8,,{ECO:0000250},,528:536;
compbias_3,,Cys-rich,,604:705;
disulfid_9,,{ECO:0000250},,559:596;
var_seq_1,,MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEI AFPTRVDHNGALLAFSPPPPRRQRRGTGATAESRLFYKVAS PSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCL YAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGG PKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGR PWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVV ADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNIL VTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHG NAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGM CERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCG ARGQDPAKLMAAHITMKTNPFVWSSCSRDYITSFLDSGLGL CLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQCKY GEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYK RVCVPFGSRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHC DSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSE FDSIPFRGKFYKWKTYRGGGVK -> MGPTSVLRAGLTPSC LPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAA ACPLLAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPR TSEKCSVLNLTASLSVGNSTSGKRTGE (in isoform 2). {ECO:0000305}. /FTId=VSP_054707.,,528:637;
disulfid_7,,{ECO:0000250},,528:531;
domain_2,,Disintegrin,,528:546;
region_1,,Spacer,,706:718;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 719-719 - Dark | 9606

Sequence:

A

Length: 1

Number of Swiss-Prot Features: 2

Swiss-Prot Features

region_1,,Spacer,,719:719;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,719:719;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 720-750 - White | 9606

Sequence:

GYEDVVWIPKGSVHIFIQDLNLSLSHLALKG

Length: 31

Number of Swiss-Prot Features: 3

Swiss-Prot Features

chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,720:750;
carbohyd_4,,N-linked (GlcNAc...). {ECO:0000255},,740:740;
region_1,,Spacer,,720:750;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 751-751 - Dark | 9606

Sequence:

D

Length: 1

Number of Swiss-Prot Features: 2

Swiss-Prot Features

chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,751:751;
region_1,,Spacer,,751:751;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 752-820 - White | 9606

Sequence:

QESLLLEGLPGTPQPHRLPLAGTTFQLRQGPDQVQSLEALGPINASLIVMVLARTELPALRYRFNAPIA

Length: 69

Number of Swiss-Prot Features: 3

Swiss-Prot Features

carbohyd_5,,N-linked (GlcNAc...). {ECO:0000255},,795:795;
region_1,,Spacer,,752:820;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,752:820;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 821-825 - Dark | 9606

Sequence:

RDSLP

Length: 5

Number of Swiss-Prot Features: 3

Swiss-Prot Features

domain_4,,TSP type-1 2. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,825:825;
region_1,,Spacer,,821:825;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,821:825;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 826-869 - White | 9606

Sequence:

PYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAH

Length: 44

Number of Swiss-Prot Features: 3

Swiss-Prot Features

region_1,,Spacer,,826:828;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,826:869;
domain_4,,TSP type-1 2. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,826:869;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 870-871 - Dark | 9606

Sequence:

SK

Length: 2

Number of Swiss-Prot Features: 2

Swiss-Prot Features

domain_4,,TSP type-1 2. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,870:871;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,870:871;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 872-917 - White | 9606

Sequence:

LPKRQRACNTEPCPPDWVVGNWSLCSRSCDAGVRSRSVVCQRRVSA

Length: 46

Number of Swiss-Prot Features: 4

Swiss-Prot Features

domain_5,,TSP type-1 3. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,884:917;
domain_4,,TSP type-1 2. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,872:883;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,872:917;
carbohyd_6,,N-linked (GlcNAc...). {ECO:0000255},,892:892;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein): 904-910,

Predicted Disorder Sections (Predict Protein): 872-872, 917-917,

Q9H324 - 918-921 - Dark | 9606

Sequence:

AEEK

Length: 4

Number of Swiss-Prot Features: 2

Swiss-Prot Features

chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,918:921;
domain_5,,TSP type-1 3. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,918:921;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 922-988 - White | 9606

Sequence:

ALDDSACPQPRPPVLEACHGPTCPPEWAALDWSECTPSCGPGLRHRVVLCKSADHRATLPPAHCSPA

Length: 67

Number of Swiss-Prot Features: 3

Swiss-Prot Features

domain_6,,TSP type-1 4. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,947:988;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,922:988;
domain_5,,TSP type-1 3. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,922:945;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 989-989 - Dark | 9606

Sequence:

A

Length: 1

Number of Swiss-Prot Features: 2

Swiss-Prot Features

chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,989:989;
domain_6,,TSP type-1 4. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,989:989;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 990-1045 - White | 9606

Sequence:

KPPATMRCNLRRCPPARWVAGEWGECSAQCGVGQRQRSVRCTSHTGQASHECTEAL

Length: 56

Number of Swiss-Prot Features: 3

Swiss-Prot Features

chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,990:1045;
domain_6,,TSP type-1 4. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,990:1001;
domain_7,,TSP type-1 5. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,1003:1045;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 1046-1047 - Dark | 9606

Sequence:

RP

Length: 2

Number of Swiss-Prot Features: 2

Swiss-Prot Features

domain_7,,TSP type-1 5. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,1046:1047;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,1046:1047;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein):

Q9H324 - 1048-1059 - White | 9606

Sequence:

PTTQQCEAKCDS

Length: 12

Number of Swiss-Prot Features: 2

Swiss-Prot Features

domain_7,,TSP type-1 5. {ECO:0000255|PROSITE-ProRule:PRU00210}.,,1048:1058;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,1048:1059;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein): 1049-1053,

Q9H324 - 1060-1103 - Dark | 9606

Sequence:

PTPGDGPEECKDVNKVAYCPLVLKFQFCSRAYFRQMCCKTCHGH

Length: 44

Number of Swiss-Prot Features: 3

Swiss-Prot Features

conflict_4,,H -> Q (in Ref. 2; AAG35563) {ECO:0000305}.,,1101:1101;
chain_1,,A disintegrin and metalloproteinase with thrombospondin motifs 10. /FTId=PRO_0000029185.,,1060:1103;
domain_8,,PLAC. {ECO:0000255|PROSITE-ProRule:PRU00233}.,,1065:1103;

Predicted Transmembrane Helixes (Predict Protein):

Predicted Transmembrane Beta Barels (Predict Protein):

Predicted Disorder Sections (Predict Protein): 1065-1065,





© Copyright 2015-2018 Nelson Perdigão and ISR-IST-ULisboa, All Rights Reserved.